PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00065g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 119aa    MW: 13981.7 Da    PI: 6.793
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00065g00016.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.2e-141156148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              rg++ ++Ed+l+++++++lG++ W++Ia +++  Rt+ ++k++w ++l
  Peaxi162Scf00065g00016.1 11 RGNFAEDEDDLIIRLHALLGNR-WSLIAGRLP-WRTGDEVKNYWSSHL 56
                              8999******************.*********.***********8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.446160IPR017930Myb domain
SMARTSM007174.3E-121058IPR001005SANT/Myb domain
SuperFamilySSF466892.69E-121164IPR009057Homeodomain-like
PfamPF002492.6E-131156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-191257IPR009057Homeodomain-like
CDDcd001671.05E-71356No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MNNLKPILEI RGNFAEDEDD LIIRLHALLG NRWSLIAGRL PWRTGDEVKN YWSSHLKQKL  60
RNMGIDPMTY RISDYVCRKS HLDLWHESRE TETNEKPCDA RSSWGQDDHE PSSLPHLKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016502778.16e-35PREDICTED: transcription factor MYB3-like
SwissprotP813931e-26MYB08_ANTMA; Myb-related protein 308
SwissprotQ9S9K91e-26MYB3_ARATH; Transcription factor MYB3
SwissprotQ9SZP11e-26MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A023PKB46e-36A0A023PKB4_PETHY; R2R3-MYB anthocyanin repressor
STRINGSolyc05g008250.1.15e-31(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.16e-28myb domain protein 3